HPA021658

INTS1 antibody from Sigma-Aldrich
DKFZp586J0619, INT1, KIAA1440, NET28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021658, RRID:AB_1852402
Product name
Anti-INTS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021658
Antibody type
Polyclonal
Antigen
Integrator complex subunit 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAE
SVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTC
GYKEVRLLAVQKLEMWLQNPK
Storage
-20C
Provider Type Product Number
- No reagents -