H00003708-M01
antibody from Abnova Corporation
Targeting: ITPR1
ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003708-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003708-M01, RRID:AB_489753
- Product name
- ITPR1 monoclonal antibody (M01), clone 2B6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITPR1.
- Antigen sequence
EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKE
EPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFA
DLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFE
EHI- Isotype
- IgG
- Antibody clone number
- 2B6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Microdomains of muscarinic acetylcholine and Ins(1,4,5)P₃ receptors create 'Ins(1,4,5)P₃ junctions' and sites of Ca²+ wave initiation in smooth muscle.
Olson ML, Sandison ME, Chalmers S, McCarron JG
Journal of cell science 2012 Nov 15;125(Pt 22):5315-28
Journal of cell science 2012 Nov 15;125(Pt 22):5315-28
No comments: Submit comment
No validations: Submit validation data