HPA014765

ITPR1 antibody from Sigma-Aldrich
ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014765, RRID:AB_1851843
Product name
Anti-ITPR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014765
Antibody type
Polyclonal
Antigen
Inositol 1,4,5-trisphosphate receptor type 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDDFILEVDRLPNETAVPETGESLASEFLFSDVCR
VESGENCSSPAPREELVPAEETEQDKEHTCETLLM
CIVTVLSHGLRS
Storage
-20C
Provider Type Product Number
- No reagents -