HPA027852

ITGB3 antibody from Sigma-Aldrich
CD61, GP3A, GPIIIa
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027852, RRID:AB_10601760
Product name
Anti-ITGB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027852
Antibody type
Polyclonal
Antigen
integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGD
TVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQ
VTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCG
P
Storage
-20C
Provider Type Product Number
- No reagents -