HPA003033

SAGE1 antibody from Atlas Antibodies
CT14, SAGE
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003033
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003033, RRID:AB_1079865
Product name
Anti-SAGE1
Provider product page
Atlas Antibodies - HPA003033
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATITYNVPEEKMEKGQPQPDNILSTASTGLINVAG
AGTPAISTNGLYSTVPHNVCEEKMENDQPQPNNVL
STVQPVIIYLTATGIPGMNTRDQYATITHNVCEER
VVNNQPLPSNALSTVLPGLAYLATADMPAMSTRDQ
H
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -