HPA003033

SAGE1 antibody from Sigma-Aldrich
CT14, SAGE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003033, RRID:AB_1079865
Product name
Anti-SAGE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003033
Antibody type
Polyclonal
Antigen
Sarcoma antigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATITYNVPEEKMEKGQPQPDNILSTASTGLINVAG
AGTPAISTNGLYSTVPHNVCEEKMENDQPQPNNVL
STVQPVIIYLTATGIPGMNTRDQYATITHNVCEER
VVNNQPLPSNALSTVLPGLAYLATADMPAMSTRDQ
H
Storage
-20C
Provider Type Product Number
- No reagents -