Antibody data

Product number
H00002187-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002187-M01, RRID:AB_1574801
Product name
FANCB monoclonal antibody (M01), clone 2B10
Provider product page
Abnova Corporation - H00002187-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FANCB.
Antigen sequence
GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNF
MQRCEVSKGKSSVVAAALSDRRENIHPYRKELQRE
KKKMLQTNLKVSGALYREITLKVAEVQLKSDFAAQ
KLSN
Isotype
IgG
Antibody clone number
2B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -