HPA003124

FANCB antibody from Sigma-Aldrich
FAAP95, FAB, FLJ34064
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003124
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003124, RRID:AB_1078813
Product name
Anti-FANCB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003124
Antibody type
Polyclonal
Antigen
Fanconi anemia group B protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSLNSDCLTSFKITDLGKINYSSEPSDCNEDDLFE
DKQENRYLVVPPLETGLKVCFSSFRELRQHLLLKE
KIISKSYKALINLVQGKDDNTSSAEEKECLVPLCG
EEENSVHILDEKLSDNFQDSEQLVEKIWY
Storage
-20C
Provider Type Product Number
- No reagents -