HPA021260

ERCC6L2 antibody from Atlas Antibodies
C9orf102, FLJ37706, RAD26L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021260
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021260, RRID:AB_1859544
Product name
Anti-ERCC6L2
Provider product page
Atlas Antibodies - HPA021260
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQY
PEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRES
LIKPRLSDSETLSFKDSTN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -