HPA003720

YIPF6 antibody from Atlas Antibodies
FinGER6, MGC21416
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003720
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003720, RRID:AB_1080626
Product name
Anti-YIPF6
Provider product page
Atlas Antibodies - HPA003720
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGLSDISISQDIPVEGEITIPMRSRIREFDSSTLN
ESVRNTIMRDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -