HPA003720

YIPF6 antibody from Sigma-Aldrich
FinGER6, MGC21416
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003720
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003720, RRID:AB_1080626
Product name
Anti-YIPF6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003720
Antibody type
Polyclonal
Antigen
Protein YIPF6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGLSDISISQDIPVEGEITIPMRSRIREFDSSTLN
ESVRNTIMRDL
Storage
-20C
Provider Type Product Number
- No reagents -