Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- NBP1-79600 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#NBP1-79600, RRID:AB_11033709
- Product name
- Rabbit Polyclonal FLJ37543 Antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human FLJ37543The immunogen for this antibody is FLJ37543. Peptide sequence PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS.
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 0.05 mg
- Concentration
- LYOPH
- Storage
- Store at -20°C. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: FLJ37543 Antibody [NBP1-79600] - Titration: 0.2-1 ug/ml, Positive Control: Human Stomach.