Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079178-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079178-M01, RRID:AB_622397
- Product name
- THTPA monoclonal antibody (M01), clone 3F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant THTPA.
- Antigen sequence
MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTF
RDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA
GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGD
VAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP
QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKI
HRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL
EVNSSRERPQETEDPDHCLG- Isotype
- IgG
- Antibody clone number
- 3F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Thiamine status in humans and content of phosphorylated thiamine derivatives in biopsies and cultured cells.
The iron-regulated metastasis suppressor, Ndrg-1: identification of novel molecular targets.
Gangolf M, Czerniecki J, Radermecker M, Detry O, Nisolle M, Jouan C, Martin D, Chantraine F, Lakaye B, Wins P, Grisar T, Bettendorff L
PloS one 2010 Oct 25;5(10):e13616
PloS one 2010 Oct 25;5(10):e13616
The iron-regulated metastasis suppressor, Ndrg-1: identification of novel molecular targets.
Kovacevic Z, Fu D, Richardson DR
Biochimica et biophysica acta 2008 Oct;1783(10):1981-92
Biochimica et biophysica acta 2008 Oct;1783(10):1981-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- THTPA monoclonal antibody (M01), clone 3F6 Western Blot analysis of THTPA expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of THTPA expression in transfected 293T cell line by THTPA monoclonal antibody (M01), clone 3F6.Lane 1: THTPA transfected lysate(25.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged THTPA is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to THTPA on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol