HPA046263

FSD2 antibody from Atlas Antibodies
RP11-127F21, SPRYD1

Antibody data

Product number
HPA046263
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046263, RRID:AB_2679604
Product name
Anti-FSD2
Provider product page
Atlas Antibodies - HPA046263
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEHLDYRVGVAFADVRKQEDLGANCLSWCMRHTFA
SSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHS
KLSFFNVDLSQHLYTFSCQLHEFVHPCF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.