HPA003156

APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR

Validated within the Antibodypedia Validation Initative

Antibody data

Submit

Validation data

Product number: HPA003156
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003156, RRID:AB_888834
Product name: Anti-ATP6AP2
Provider product page: Atlas Antibodies - HPA003156
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows positivity in islets of Langerhans.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003156 antibody. Corresponding ATP6AP2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.