HPA003156
antibody from Atlas Antibodies
Targeting: ATP6AP2
APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR
Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003156 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003156, RRID:AB_1078245
- Product name
- Anti-ATP6AP2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK
DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR
KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension.
Angiotensin II increases the expression of (pro)renin receptor during low-salt conditions.
Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice
The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein.
Distinct signal transduction pathways downstream of the (P)RR revealed by microarray and ChIP-chip analyses.
Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension.
Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats.
Gonzalez AA, Green T, Luffman C, Bourgeois CR, Gabriel Navar L, Prieto MC
American journal of physiology. Renal physiology 2014 Oct 15;307(8):F962-70
American journal of physiology. Renal physiology 2014 Oct 15;307(8):F962-70
Angiotensin II increases the expression of (pro)renin receptor during low-salt conditions.
Gonzalez AA, Womack JP, Liu L, Seth DM, Prieto MC
The American journal of the medical sciences 2014 Nov;348(5):416-22
The American journal of the medical sciences 2014 Nov;348(5):416-22
Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice
Rosendahl A, Niemann G, Lange S, Ahadzadeh E, Krebs C, Contrepas A, van Goor H, Wiech T, Bader M, Schwake M, Peters J, Stahl R, Nguyen G, Wenzel U
Laboratory Investigation 2014 July;94(8):863-872
Laboratory Investigation 2014 July;94(8):863-872
The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein.
Kirsch S, Schrezenmeier E, Klare S, Zaade D, Seidel K, Schmitz J, Bernhard S, Lauer D, Slack M, Goldin-Lang P, Unger T, Zollmann FS, Funke-Kaiser H
International journal of molecular medicine 2014 Apr;33(4):795-808
International journal of molecular medicine 2014 Apr;33(4):795-808
Distinct signal transduction pathways downstream of the (P)RR revealed by microarray and ChIP-chip analyses.
Zaade D, Schmitz J, Benke E, Klare S, Seidel K, Kirsch S, Goldin-Lang P, Zollmann FS, Unger T, Funke-Kaiser H
PloS one 2013;8(3):e57674
PloS one 2013;8(3):e57674
Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension.
Prieto MC, Williams DE, Liu L, Kavanagh KL, Mullins JJ, Mitchell KD
American journal of physiology. Renal physiology 2011 Feb;300(2):F581-8
American journal of physiology. Renal physiology 2011 Feb;300(2):F581-8
Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats.
Gonzalez AA, Lara LS, Luffman C, Seth DM, Prieto MC
Hypertension (Dallas, Tex. : 1979) 2011 Apr;57(4):859-64
Hypertension (Dallas, Tex. : 1979) 2011 Apr;57(4):859-64
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATP6AP2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and ATP6AP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417089).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003156 antibody. Corresponding ATP6AP2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows positivity in islets of Langerhans.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate cytoplasmic/ membranous positivity in cells in granular layer.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic/ membranous positivity in neurons and moderately stained neuropil.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate cytoplasmic/ membranous positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
- Sample type
- HUMAN