HPA003156

ATP6AP2 antibody from Atlas Antibodies

APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR

Validated within the Antibodypedia Validation Initative

Western blot

Enhanced validation

Immunohistochemistry

Enhanced validation

Provider product page for HPA003156

Antibody Data

Product number

HPA003156

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA003156, RRID:AB_1078245

Product name

Anti-ATP6AP2

Provider product page

Antibody type

Polyclonal

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK
DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR
KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension
Gonzalez A, Green T, Luffman C, Bourgeois C, Gabriel Navar L, Prieto M
AJP: Renal Physiology 2014 October;307(8)

---

Angiotensin II Increases the Expression of (Pro)Renin Receptor During Low-Salt Conditions
Gonzalez A, Womack J, Liu L, Prieto M, Seth D
The American Journal of the Medical Sciences 2014 November;348(5):416-422

---

Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice
Rosendahl A, Niemann G, Lange S, Ahadzadeh E, Krebs C, Contrepas A, van Goor H, Wiech T, Bader M, Schwake M, Peters J, Stahl R, Nguyen G, Wenzel U
Laboratory Investigation 2014 July;94(8):863-872

---

The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein
Funke-Kaiser H
International Journal of Molecular Medicine 2014 January

---

Distinct Signal Transduction Pathways Downstream of the (P)RR Revealed by Microarray and ChIP-chip Analyses
Zaade D, Schmitz J, Benke E, Klare S, Seidel K, Kirsch S, Goldin-Lang P, Zollmann F, Unger T, Funke-Kaiser H, Datta P
PLoS ONE 2013 March;8(3)

---

Soluble Form of the (Pro)Renin Receptor Is Augmented in the Collecting Duct and Urine of Chronic Angiotensin II-Dependent Hypertensive Rats
Gonzalez A, Lara L, Luffman C, Seth D, Prieto M
Hypertension 2011 March;57(4):859-864

---

Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension
Prieto M, Williams D, Liu L, Kavanagh K, Mullins J, Mitchell K
AJP: Renal Physiology 2011 February;300(2)

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATP6AP2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Recombinant expression validation

Main image

Experimental details

Western blot analysis in control (vector only transfected HEK293T lysate) and ATP6AP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417089).

Sample type

HUMAN

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows positivity in trophoblastic cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows positivity in islets of Langerhans.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic/ membranous positivity in cells in granular layer.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic/ membranous positivity in neurons and moderately stained neuropil.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human placenta shows moderate cytoplasmic/ membranous positivity in trophoblastic cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Sample type

HUMAN

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA003156 antibody. Corresponding ATP6AP2 RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more