HPA003156

ATP6AP2 antibody from Atlas Antibodies
APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003156
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003156, RRID:AB_1078245
Product name
Anti-ATP6AP2
Provider product page
Atlas Antibodies - HPA003156
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK
DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR
KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -