Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15713 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15713, RRID:AB_10679164
- Product name
- Astn1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Astn1.
- Antigen sequence
LYHYNQHYESFGEFTWRCEDELGPRKAGLILSQLG
DLSSWCNGLLQEPKISLRRGSLKYLGCRYSEIKPY
GLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Prediction of the coding sequences of mouse homologues of KIAA gene: I. The complete nucleotide sequences of 100 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Hara Y, Nagase T, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Oct 31;9(5):179-88
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Oct 31;9(5):179-88
No comments: Submit comment
No validations: Submit validation data