Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00414899-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00414899-B01, RRID:AB_1017352
- Product name
- BRCC2 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Antigen
- BRCC2 (NP_001001786.1, 1 a.a. ~ 108 a.a) full-length human protein.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MVTLLPIEGQEVHFFEILESECVLYTGWIERASGS
SIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRY
NLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSA
EAL- Vial size
- 50 µl
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hypoxia-induced gene expression results from selective mRNA partitioning to the endoplasmic reticulum.
Staudacher JJ, Naarmann-de Vries IS, Ujvari SJ, Klinger B, Kasim M, Benko E, Ostareck-Lederer A, Ostareck DH, Bondke Persson A, Lorenzen S, Meier JC, Blüthgen N, Persson PB, Henrion-Caude A, Mrowka R, Fähling M
Nucleic acids research 2015 Mar 31;43(6):3219-36
Nucleic acids research 2015 Mar 31;43(6):3219-36
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BLID expression in transfected 293T cell line (H00414899-T01) by BLID MaxPab polyclonal antibody.Lane 1: BRCC2 transfected lysate(11.88 KDa).Lane 2: Non-transfected lysate.
- Validation comment
- Western Blot (Transfected lysate)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to BRCC2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol