HPA007721

PLCXD1 antibody from Sigma-Aldrich
FLJ11323
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007721
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007721, RRID:AB_1079630
Product name
Anti-PLCXD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007721
Antibody type
Polyclonal
Antigen
phosphatidylinositol-specific phospholipase C, X domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDL
RIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
L
Storage
-20C
Provider Type Product Number
- No reagents -