HPA003157

BGN antibody from Sigma-Aldrich
DSPG1, SLRR1A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003157, RRID:AB_1078282
Product name
Anti-BGN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003157
Antibody type
Polyclonal
Antigen
Biglycan precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVT
PTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPD
TTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKI
SKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
Storage
-20C
Provider Type Product Number
- No reagents -