HPA020974

PHF24 antibody from Sigma-Aldrich
KIAA1045
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020974
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020974, RRID:AB_1852364
Product name
Anti-KIAA1045 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020974
Antibody type
Polyclonal
Antigen
Protein KIAA1045 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRH
QAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHI
EWPDFLSHESLLLLQQLR
Storage
-20C
Provider Type Product Number
- No reagents -