HPA000864

FKBP3 antibody from Sigma-Aldrich
FKBP-25, PPIase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000864
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000864, RRID:AB_1078873
Product name
Anti-FKBP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000864
Antibody type
Polyclonal
Antigen
FK506-binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTA
NKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVK
LNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNF
PKKGDVVHCWYTGTLQDGT
Storage
-20C
Provider Type Product Number
- No reagents -