Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183930 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CUGBP2 antibody: synthetic peptide directed towards the N terminal of human CUGBP2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQ
NALHN IKTLPGMHHP- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of CELF splicing activation and repression domains in vivo.
Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
Han J, Cooper TA
Nucleic acids research 2005;33(9):2769-80
Nucleic acids research 2005;33(9):2769-80
Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
Han C, Liu H, Liu J, Yin K, Xie Y, Shen X, Wang Y, Yuan J, Qiang B, Liu YJ, Peng X
Nucleic acids research 2005;33(20):6555-65
Nucleic acids research 2005;33(20):6555-65
No comments: Submit comment
No validations: Submit validation data