Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502005 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CUGBP, Elav-Like Family Member 2 (CELF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CUGBP2 antibody: synthetic peptide directed towards the N terminal of human CUGBP2
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGAL
DHSDQ PDPDAIKMFV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Translation inhibition during cell cycle arrest and apoptosis: Mcl-1 is a novel target for RNA binding protein CUGBP2.
Subramaniam D, Natarajan G, Ramalingam S, Ramachandran I, May R, Queimado L, Houchen CW, Anant S
American journal of physiology. Gastrointestinal and liver physiology 2008 Apr;294(4):G1025-32
American journal of physiology. Gastrointestinal and liver physiology 2008 Apr;294(4):G1025-32
No comments: Submit comment
No validations: Submit validation data