HPA003183

NLGN3 antibody from Sigma-Aldrich
ASPGX1, AUTSX1, HNL3, KIAA1480
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003183
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003183, RRID:AB_1079469
Product name
Anti-NLGN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003183
Antibody type
Polyclonal
Antigen
Neuroligin-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVP
YAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQ
NIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLY
LNVYVPTED
Storage
-20C
Provider Type Product Number
- No reagents -