Antibody data

Product number
H00086614-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00086614-B01, RRID:AB_1113964
Product name
HSFY1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00086614-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HSFY1 protein.
Antigen sequence
MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPG
DSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPD
KDDDFLSLNFPRKLWKIVESDQFKSISWDENGTCI
VINEELFKKEILETKAPYRIFQTDAIKSFVRQLNL
YGFSKIQQNFQRSAFLATFLSEEKESSVLSKLKFY
YNPNFKRGYPQLLVRVKRRIGVKNASPISTLFNED
FNKKHFRAGANMENHNSALAAEASEESLFSASKNL
NMPLTRESSVRQIIANSSVPIRSGFPPPSPSTSVG
PSEQIATDQHAILNQLTTIHMHSHSTYMQARGHIV
NFITTTTSQYHIISPLQNGYFGLTVEPSAVPTRYP
LVSVNEAPYRNMLPAGNPWLQMPTIADRSAAPHSR
LALQPSPLDKYHPNYN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.