Antibody data

Product number
H00086614-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00086614-M10, RRID:AB_1137261
Product name
HSFY1 monoclonal antibody (M10), clone 1D2
Provider product page
Abnova Corporation - H00086614-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HSFY1.
Antigen sequence
MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPG
DSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPD
KDDDFLSLNFPRKLWKIVESDQFKSISWD
Isotype
IgG
Antibody clone number
1D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -