Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA051074 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA051074, RRID:AB_2681334
- Product name
- Anti-OTULIN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKK
EWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYC
ALRATLFQAMSQAVGLPPWLQDPELMLLP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The de novo synthesis of ubiquitin: identification of deubiquitinases acting on ubiquitin precursors.
Grou CP, Pinto MP, Mendes AV, Domingues P, Azevedo JE
Scientific reports 2015 Aug 3;5:12836
Scientific reports 2015 Aug 3;5:12836
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines HeLa and MCF-7 using Anti-OTULIN antibody. Corresponding OTULIN RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN