HPA003187

APOO antibody from Sigma-Aldrich
FAM121B, MGC4825, Mic23, MIC26, My025
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003187, RRID:AB_1079375
Product name
Anti-APOO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003187
Antibody type
Polyclonal
Antigen
Apolipoprotein O precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLY
DWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Storage
-20C
Provider Type Product Number
- No reagents -