HPA062737

KBTBD13 antibody from Atlas Antibodies
hCG_1645727, NEM6

Antibody data

Product number
HPA062737
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062737, RRID:AB_2684856
Product name
Anti-KBTBD13
Provider product page
Atlas Antibodies - HPA062737
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGF
CYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.