Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003539 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003539, RRID:AB_1078438
- Product name
- Anti-IL3RA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYS
MPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWI
LFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPG
APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIG
CRFDDIS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Metastasis to sentinel lymph nodes in breast cancer is associated with maturation arrest of dendritic cells and poor co-localization of dendritic cells and CD8+ T cells
Mansfield A, Heikkila P, von Smitten K, Vakkila J, Leidenius M
Virchows Archiv 2011 October;459(4):391-398
Virchows Archiv 2011 October;459(4):391-398
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and IL3RA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419481).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN