HPA003539

IL3RA antibody from Atlas Antibodies
CD123
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003539
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003539, RRID:AB_611371
Product name
Anti-IL3RA
Provider product page
Atlas Antibodies - HPA003539
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYS
MPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWI
LFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPG
APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIG
CRFDDIS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -