HPA021085

RGP1 antibody from MilliporeSigma / Merck KGaA
KIAA0258
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021085
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021085, RRID:AB_1852291
Product name
Anti-RGP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021085
Antibody type
Polyclonal
Antigen
Retrograde Golgi transport protein RGP1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQR
VNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSS
PFLEEDEGGKKDS
Storage
-20C
Provider Type Product Number
- No reagents -