HPA023011

FAM221B antibody from Sigma-Aldrich
C9orf128
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023011, RRID:AB_1845809
Product name
Anti-C9orf128 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023011
Antibody type
Polyclonal
Antigen
hypothetical protein LOC392307 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTLPPQSRDYVCLSSSDTLKEDLSSESSSNEVPWT
RRSTHLSESESLPEHCLSGPSSQVQVDTTEKQEEE
AGEVEKGVDASDSTAHTAQPG
Storage
-20C
Provider Type Product Number
- No reagents -