Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AP45232PU-N - Provider product page

- Provider
- Acris Antibodies GmbH
- Product name
- anti ZNF93
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
- Reactivity
- Human, Mouse, Rat, Bovine, Zebrafish
- Host
- Rabbit
- Vial size
- 50 µg
- Concentration
- 1.0 mg/ml after reconstitution
No comments: Submit comment
Supportive validation
- Submitted by
- Acris Antibodies GmbH (provider)
- Main image

- Experimental details
- Western blotting of 721-B cell lysate using anti-ZNF93 antibody cat.no. AP45232PU-N at a concentration of 1.0 µg/ml
- Submitted by
- Acris Antibodies GmbH (provider)
- Main image

- Experimental details
- Human 721_B; WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: 721_B cell lysate. ZNF93 is supported by BioGPS gene expression data to be expressed in 721_B.; ZNF93 antibody - N-terminal region (AP45232PU-N) in Human 721_B cells using Western Blot