HPA011324

MAGEH1 antibody from Sigma-Aldrich
APR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011324
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011324, RRID:AB_1853499
Product name
Anti-MAGEH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011324
Antibody type
Polyclonal
Antigen
Melanoma-associated antigen H1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGKLGMQPGRQHSIFGDPKKIVTEEFVRRGYLIYK
PVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVR
NRCSKDWPCNYDWDSDDDAEVEAILNSGARG
Storage
-20C
Provider Type Product Number
- No reagents -