HPA021514

OSBP2 antibody from Sigma-Aldrich
KIAA1664, ORP-4, ORP4, OSBPL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021514
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021514, RRID:AB_1854813
Product name
Anti-OSBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021514
Antibody type
Polyclonal
Antigen
Oxysterol-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERA
FHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTE
YFDAMEDSTSFITV
Storage
-20C
Provider Type Product Number
- No reagents -