Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007576-M01 - Provider product page

- Provider
- Abnova Corporation
- Product name
- ZNF28 monoclonal antibody (M01), clone 8H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant ZNF28.
- Antigen sequence
MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRD
VMLENYRNLVSLGEDNLLGMCPCVSLYFLLLPLGS
HILT- Isotype
- IgG
- Antibody clone number
- 8H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZNF28 monoclonal antibody (M01), clone 8H6. Western Blot analysis of ZNF28 expression in NIH/3T3.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZNF28 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol