Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006705-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006705-M03, RRID:AB_10616914
- Product name
- SPRR2F monoclonal antibody (M03), clone 5A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant SPRR2F.
- Antigen sequence
MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEP
CPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPK
SK- Isotype
- IgG
- Antibody clone number
- 5A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9.Lane 1: SPRR2F transfected lysate(7.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SPRR2F is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol