HPA005841

EIF2B2 antibody from Atlas Antibodies
EIF-2Bbeta, EIF2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005841
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005841, RRID:AB_888990
Product name
Anti-EIF2B2
Provider product page
Atlas Antibodies - HPA005841
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVN
KVIIGTKTILANGALRAVTGTHTLALAAKHHSTPL
IVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSY
IYRLMSELYH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -