HPA005841

EIF2B2 antibody from Sigma-Aldrich
EIF-2Bbeta, EIF2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005841
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005841, RRID:AB_1078725
Product name
Anti-EIF2B2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005841
Antibody type
Polyclonal
Antigen
Translation initiation factor eIF-2B subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVN
KVIIGTKTILANGALRAVTGTHTLALAAKHHSTPL
IVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSY
IYRLMSELYH
Storage
-20C
Provider Type Product Number
- No reagents -