H00029978-M03
antibody from Abnova Corporation
Targeting: UBQLN2
Chap1, CHAP1/DSK2, Dsk2, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Antibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029978-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029978-M03, RRID:AB_565683
- Product name
- UBQLN2 monoclonal antibody (M03), clone 5F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBQLN2.
- Antigen sequence
PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQL
NAMGFLNREANLQALIATGGDINAAIERLLGSQPS- Isotype
- IgG
- Antibody clone number
- 5F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3.
Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases.
C9ORF72 repeat-associated non-ATG-translated polypeptides are distributed independently of TDP-43 in a Japanese patient with c9ALS.
C9ORF72, implicated in amytrophic lateral sclerosis and frontotemporal dementia, regulates endosomal trafficking.
Lower motor neuron involvement in TAR DNA-binding protein of 43 kDa-related frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Progressive amnestic dementia, hippocampal sclerosis, and mutation in C9ORF72.
Tau pathology in frontotemporal lobar degeneration with C9ORF72 hexanucleotide repeat expansion.
Ubiquilin-1 immunoreactivity is concentrated on Hirano bodies and dystrophic neurites in Alzheimer's disease brains.
Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion.
p62 positive, TDP-43 negative, neuronal cytoplasmic and intranuclear inclusions in the cerebellum and hippocampus define the pathology of C9orf72-linked FTLD and MND/ALS.
Zeng L, Wang B, Merillat SA, Minakawa EN, Perkins MD, Ramani B, Tallaksen-Greene SJ, Costa Mdo C, Albin RL, Paulson HL
Neurobiology of disease 2015 Oct;82:281-8
Neurobiology of disease 2015 Oct;82:281-8
Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases.
Porta S, Kwong LK, Trojanowski JQ, Lee VM
Journal of neuropathology and experimental neurology 2015 Apr;74(4):380-7
Journal of neuropathology and experimental neurology 2015 Apr;74(4):380-7
C9ORF72 repeat-associated non-ATG-translated polypeptides are distributed independently of TDP-43 in a Japanese patient with c9ALS.
Konno T, Tada M, Shiga A, Tsujino A, Eguchi H, Masuda-Suzukake M, Hasegawa M, Nishizawa M, Onodera O, Kakita A, Takahashi H
Neuropathology and applied neurobiology 2014 Oct;40(6):783-8
Neuropathology and applied neurobiology 2014 Oct;40(6):783-8
C9ORF72, implicated in amytrophic lateral sclerosis and frontotemporal dementia, regulates endosomal trafficking.
Farg MA, Sundaramoorthy V, Sultana JM, Yang S, Atkinson RA, Levina V, Halloran MA, Gleeson PA, Blair IP, Soo KY, King AE, Atkin JD
Human molecular genetics 2014 Jul 1;23(13):3579-95
Human molecular genetics 2014 Jul 1;23(13):3579-95
Lower motor neuron involvement in TAR DNA-binding protein of 43 kDa-related frontotemporal lobar degeneration and amyotrophic lateral sclerosis.
Riku Y, Watanabe H, Yoshida M, Tatsumi S, Mimuro M, Iwasaki Y, Katsuno M, Iguchi Y, Masuda M, Senda J, Ishigaki S, Udagawa T, Sobue G
JAMA neurology 2014 Feb;71(2):172-9
JAMA neurology 2014 Feb;71(2):172-9
Progressive amnestic dementia, hippocampal sclerosis, and mutation in C9ORF72.
Murray ME, Bieniek KF, Banks Greenberg M, DeJesus-Hernandez M, Rutherford NJ, van Blitterswijk M, Niemantsverdriet E, Ash PE, Gendron TF, Kouri N, Baker M, Goodman IJ, Petrucelli L, Rademakers R, Dickson DW
Acta neuropathologica 2013 Oct;126(4):545-54
Acta neuropathologica 2013 Oct;126(4):545-54
Tau pathology in frontotemporal lobar degeneration with C9ORF72 hexanucleotide repeat expansion.
Bieniek KF, Murray ME, Rutherford NJ, Castanedes-Casey M, DeJesus-Hernandez M, Liesinger AM, Baker MC, Boylan KB, Rademakers R, Dickson DW
Acta neuropathologica 2013 Feb;125(2):289-302
Acta neuropathologica 2013 Feb;125(2):289-302
Ubiquilin-1 immunoreactivity is concentrated on Hirano bodies and dystrophic neurites in Alzheimer's disease brains.
Satoh J, Tabunoki H, Ishida T, Saito Y, Arima K
Neuropathology and applied neurobiology 2013 Dec;39(7):817-30
Neuropathology and applied neurobiology 2013 Dec;39(7):817-30
Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion.
Brettschneider J, Van Deerlin VM, Robinson JL, Kwong L, Lee EB, Ali YO, Safren N, Monteiro MJ, Toledo JB, Elman L, McCluskey L, Irwin DJ, Grossman M, Molina-Porcel L, Lee VM, Trojanowski JQ
Acta neuropathologica 2012 Jun;123(6):825-39
Acta neuropathologica 2012 Jun;123(6):825-39
p62 positive, TDP-43 negative, neuronal cytoplasmic and intranuclear inclusions in the cerebellum and hippocampus define the pathology of C9orf72-linked FTLD and MND/ALS.
Al-Sarraj S, King A, Troakes C, Smith B, Maekawa S, Bodi I, Rogelj B, Al-Chalabi A, Hortobágyi T, Shaw CE
Acta neuropathologica 2011 Dec;122(6):691-702
Acta neuropathologica 2011 Dec;122(6):691-702
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBQLN2 monoclonal antibody (M03), clone 5F5 Western Blot analysis of UBQLN2 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBQLN2 monoclonal antibody (M03), clone 5F5. Western Blot analysis of UBQLN2 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBQLN2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol