HPA006431

UBQLN2 antibody from Atlas Antibodies
Chap1, CHAP1/DSK2, Dsk2, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006431
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006431, RRID:AB_1078707
Product name
Anti-UBQLN2
Provider product page
Atlas Antibodies - HPA006431
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFT
PGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGP
IGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETT
SPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRF
QQQLEQLN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -