HPA006431

UBQLN2 antibody from Sigma-Aldrich
Chap1, CHAP1/DSK2, Dsk2, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006431
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006431, RRID:AB_1078707
Product name
Anti-UBQLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006431
Antibody type
Polyclonal
Antigen
Ubiquilin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFT
PGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGP
IGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETT
SPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRF
QQQLEQLN
Storage
-20C
Provider Type Product Number
- No reagents -