HPA019515

IQCE antibody from Sigma-Aldrich
KIAA1023
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019515
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019515, RRID:AB_1851855
Product name
Anti-IQCE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019515
Antibody type
Polyclonal
Antigen
IQ domain-containing protein E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGY
VEWSKPRLLRRIVELEKKLSVMESSKSHAAEPVRS
HPPACLASSSALHRQPRGDRNKDHERLR
Storage
-20C
Provider Type Product Number
- No reagents -