Antibody data
- Product number
- HPA004003
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004003, RRID:AB_2667113
- Product name
- Anti-CXorf67
- Provider product page
- Atlas Antibodies - HPA004003
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITD
EASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPE
GGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQP
CRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPC
SGAST
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell line U-2 OS and human cell line A-549.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Western blot analysis using Anti-CXorf67 antibody HPA004003 (A) shows similar pattern to independent antibody HPA006128 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA006128
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in fraction of cells in seminiferous ducts.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human placenta shows weak nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human kidney, liver, skeletal muscle and testis using Anti-CXorf67 antibody HPA004003 (A) shows similar protein distribution across tissues to independent antibody HPA006128 (B).
- Antibody #2 product nr
- HPA006128
- Antibody provider
- Atlas Antibodies
- Show more