HPA004003

EZHIP antibody from Atlas Antibodies
CATACOMB, CXorf67

Antibody data

Product number
HPA004003
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004003, RRID:AB_2667113
Product name
Anti-CXorf67
Provider product page
Atlas Antibodies - HPA004003
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITD
EASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPE
GGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQP
CRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPC
SGAST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.