H00389840-A01

MAP3K15 antibody from Abnova Corporation
ASK3, bA723P2.3, FLJ16518
No application information provided.

Antibody data

Product number
H00389840-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00389840-A01, RRID:AB_563260
Product name
MAP3K15 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00389840-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant MAP3K15.
Antigen sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL
QGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRL
RGGLLCRLWSAVSQYRRAQEASETKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -