H00389840-M02

MAP3K15 antibody from Abnova Corporation
ASK3, bA723P2.3, FLJ16518

Antibody data

Product number
H00389840-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00389840-M02, RRID:AB_1137292
Product name
MAP3K15 monoclonal antibody (M02), clone 1H7
Provider product page
Abnova Corporation - H00389840-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAP3K15.
Antigen sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL
QGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRL
RGGLLCRLWSAVSQYRRAQEASETKD
Isotype
IgG
Antibody clone number
1H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -