HPA004006

MAP3K15 antibody from Sigma-Aldrich
ASK3, bA723P2.3, FLJ16518
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004006
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004006, RRID:AB_1079358
Product name
Anti-MAP3K15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004006
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGDREKALQIMLQVLQSCDHPGPDMFCLCGRIYKD
IFLDSDCKDDTSRDSAIEWYRKGFELQSSLYSGIN
LAVLLIVAGQQFETSLELRKIGVRLNSLLGRKGSL
EKMNNYWDVGQFFSVSMLAHDVGKAVQAAERLFKL
Storage
-20C
Provider Type Product Number
- No reagents -