HPA021800

TRMT10B antibody from Atlas Antibodies
bA3J10.9, FLJ31455, RG9MTD3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021800
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021800, RRID:AB_1856214
Product name
Anti-TRMT10B
Provider product page
Atlas Antibodies - HPA021800
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQ
EYMVRNQNGKNYHSEILAINQVFDILSTYLETHNW
PEALKKGVSSGKGYILRNSV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -