HPA021800

TRMT10B antibody from Sigma-Aldrich
bA3J10.9, FLJ31455, RG9MTD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021800, RRID:AB_1856214
Product name
Anti-RG9MTD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021800
Antibody type
Polyclonal
Antigen
RNA recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQ
EYMVRNQNGKNYHSEILAINQVFDILSTYLETHNW
PEALKKGVSSGKGYILRNSV
Storage
-20C
Provider Type Product Number
- No reagents -