HPA018945

NYNRIN antibody from Atlas Antibodies
CGIN1, FLJ11811, KIAA1305
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018945
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018945, RRID:AB_1859538
Product name
Anti-NYNRIN
Provider product page
Atlas Antibodies - HPA018945
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PNLLALQLSDSTLADIIARLQAGQKLSGSSPFSSA
FNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLI
FSVHDVPLGAHQRPEETYKKLRLLGWWPGMQEHVK
DYCRSCLFCIPRNLIGSELKVIES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -